HPA019693

Anti-LSP1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-47 kDa actin-binding protein, Anti-52 kDa phosphoprotein, Anti-Lymphocyte-specific antigen WP34, Anti-Lymphocyte-specific protein 1, Anti-Protein pp52
• Número MDL: MFCD01633599
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA019693
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:1000-1:2500
• secuencia del inmunógeno: PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTK
• Nº de acceso UniProt: P33241
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... LSP1(4046)

Descripción

Descripción general

LSP1 (Lymphocyte-specific protein 1) is a 47kDa F-actin binding phosphoprotein consisting of mainly two domains, an N-terminal acidic domain and a C-terminal basic domain. The basic domain further is composed of multiple conserved, putative serine/threonine phosphorylation sites. In addition to these two domains, it has additional Ca2(+)-binding site.

LSP1 gene is mapped to human chromosome 11p15. It has 20 exons.

Inmunógeno

Lymphocyte-specific protein 1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-LSP1 antibody produced in rabbit has been used in:

• immunoprecipitation
• western blots
• proximity ligation assay (PLA)

Acciones bioquímicas o fisiológicas

LSP1 (Lymphocyte-specific protein 1) is an actin binding protein. It is phosphorylated via MAPKAPK2 (MK2) directed pathway, which further plays a vital role in the F-actin polarization during neutrophil chemotaxis.

LSP1 controls the migration of immune cell in inflammation and phagocytosis. It also modulates cell adhesion.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST74191

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable