Saltar al contenido
Merck
Todas las fotos(10)

Documentos clave

HPA018820

Sigma-Aldrich

Anti-HOOK1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Sinónimos:

Anti-Protein Hook homolog 1, Anti-h-hook1, Anti-hHK1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

rat, human

validación mejorada

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

secuencia del inmunógeno

AFEMKRLEEKHEALLKEKERLIEQRDTLKETNEELRCSQVQQDHLNQTDASATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIEELQE

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... HOOK1(51361)

Descripción general

The gene Hook homolog-1 (HOOK1) is mapped to human chromosome 1p32.1. It belongs to HOOK family of proteins. HOOK1 transcript is highly expressed in testis. The protein is present to discrete punctate subcellular structures.

Inmunógeno

Protein Hook homolog 1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-HOOK1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

Protein Hook homolog-1 (HOOK1) has been shown to associate with microtubules. HOOK1 is important for cellular trafficking. It is involved in sorting of clathrin independent cargo proteins toward recycling in microtubule-dependent manner. HOOK1 in complex with FTS (fused toes) and FHIP (FTS and Hook Interacting Protein) interacts with components of the homotypic vesicular protein sorting (HOPS) complex. This interaction is important for vesicle trafficking. Absence of HOOK1 function in the azh (abnormal spermatozoon head shape) mutant mouse results in abnormalities in shape of sperm head and negatively affects attachment of the flagellum to the sperm head.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST74486

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Irene Mendoza-Lujambio et al.
Human molecular genetics, 11(14), 1647-1658 (2002-06-21)
In mice carrying the autosomal recessive mutation 'abnormal spermatozoon head shape' (azh) all spermatozoa display a highly abnormal head morphology that differs drastically from the compact and hook-shaped head of the normal murine sperm. Moreover, the azh mutation causes tail
Lai Xu et al.
Molecular biology of the cell, 19(12), 5059-5071 (2008-09-19)
Fused Toes (FTS) is a member of a small group of inactive variant E2 ubiquitin-conjugating enzyme domain-containing proteins of unknown function. Through proteomic analysis of FTS complexes purified from human embryonic kidney 293T cells, we identified a new multiprotein complex
J H Walenta et al.
The Journal of cell biology, 152(5), 923-934 (2001-03-10)
Microtubules are central to the spatial organization of diverse membrane-trafficking systems. Here, we report that Hook proteins constitute a novel family of cytosolic coiled coil proteins that bind to organelles and to microtubules. The conserved NH(2)-terminal domains of Hook proteins
Wenfeng Li et al.
Medical oncology (Northwood, London, England), 31(9), 118-118 (2014-07-30)
Enhanced glycolysis is a common trait of many types of human cancers. This study was to detect the expression pattern of three regulatory enzymes during glycolysis in esophageal squamous cell carcinoma (ESCC) and to investigate their correlation with patients' outcome
Morgan Stathem et al.
Journal of cellular biochemistry, 116(1), 67-80 (2014-08-26)
Cancer therapeutics has seen an emergence and re-emergence of two metabolic fields in recent years, those of bioactive sphingolipids and glycolytic metabolism. Anaerobic glycolysis and its implications in cancer have been at the forefront of cancer research for over 90

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico