HPA015497

Anti-TMEM115 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-PP6, Anti-Placental protein 6, Anti-Protein PL6, Anti-Transmembrane protein 115
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA015497
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry: 1:50- 1:200
• secuencia del inmunógeno: KTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITF
• Nº de acceso UniProt: Q12893
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TMEM115(11070)

Descripción

Descripción general

TMEM115 (transmembrane protein 115) is a receptor-like transmembrane Golgi-resident protein, which spans the membrane six to eight times. This gene is localized to human chromosome 3p21.3, spans 4.5kb, and consists of two exons. The encoded 2.2kb mRNA is expressed in multiple normal human tissues such as, breast, lung and kidney. It has a strong and ubiquitous expression pattern in embryo and placenta. This protein is also co-expressed with RAS oncogenic protein family members. It has a pheromone-binding domain, which consists of a rhomboid-like motif. The N- and C-termini face the cytosol, with the C-terminal being composed of ~146 amino acids, and is hydrophobic in nature. The molecular weight of this protein is ~35kDa.

Inmunógeno

Transmembrane protein 115 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-TMEM115 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

TMEM115 (transmembrane protein 115) might be involved in signaling pathways. This gene is severely down-regulated in clear cell renal cell carcinomas (CC-RCCs). This expression pattern is dependent on von Hippel-Lindau tumor suppressor gene (VHL)-association of the cancer, rather than hypoxia or HIF1 (hypoxia-inducible factor). It interacts with conserved oligomeric Golgi (COG) complex, and is involved in Golgi-to-ER (endoplasmic reticulum) retrograde transport, which controls Golgi stacks. This protein also plays an essential role in O-linked glycosylation.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73276

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)