Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

HPA015138

Sigma-Aldrich

Anti-SLC41A1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Solute carrier family 41 member 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41
conjugado:
unconjugated
application:
IHC
clon:
polyclonal
reactividad de especies:
human
citations:
3
técnicas:
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

secuencia del inmunógeno

QASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSAR

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

Descripción general

SLC41A1 (solute carrier family 41, member 1) is a cytoplasmic integral membrane protein, and has either ten or eleven transmembrane domains. The N-terminal faces the cytoplasm. This gene is located on human chromosome 1q31-32, and codes for a protein composed of 513 amino acids, and a molecular weight of 56kDa. It has a wide range of tissue expression, and is found in heart, thyroid gland, muscle, testis, and kidney.

Inmunógeno

Solute carrier family 41 member 1 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

SLC41A1 (solute carrier family 41, member 1) is a Mg2+ transporter, and exchanges extracellular Na+ for intracellular Mg2+ ions (NME, Na+/Mg2+ exchanger). This process is basic for multiple cellular activities such as maintenance of cell pH, ion concentration, volume, production of cellular energy etc. A gain-of-function mutation, p.A350V, in this gene is linked to Parkinson′s disease. It is up-regulated in preeclamptic placentas, and thus, Mg2+ homeostasis might play a role in preeclampsia development. Mutation in this gene results in a phenotype very similar to nephronophthisis.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72512

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Martin Kolisek et al.
Hypertension in pregnancy, 32(4), 378-389 (2013-07-13)
To examine expression profile of magnesium responsive genes (MRGs) in placentas of normoevolutive and preeclamptic women. The expression profiles of MRGs were determined in placentas of normoevolutive (N=26) and preeclamptic (N=25) women by RT-qPCR. Among all tested MRGs (9) only
Martin Kolisek et al.
PloS one, 8(8), e71096-e71096 (2013-08-27)
Parkinson's disease (PD) is a complex multifactorial ailment predetermined by the interplay of various environmental and genetic factors. Systemic and intracellular magnesium (Mg) deficiency has long been suspected to contribute to the development and progress of PD and other neurodegenerative
Toby W Hurd et al.
Journal of the American Society of Nephrology : JASN, 24(6), 967-977 (2013-05-11)
Nephronophthisis (NPHP)-related ciliopathies are recessive, single-gene disorders that collectively make up the most common genetic cause of CKD in the first three decades of life. Mutations in 1 of the 15 known NPHP genes explain less than half of all

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico