HPA014101

Anti-CHRM1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Muscarinic acetylcholine receptor M1
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA014101
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunohistochemistry: 1:1000- 1:2500
• secuencia del inmunógeno: SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
• Nº de acceso UniProt: P11229
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CHRM1(1128)

Descripción

Descripción general

The gene CHRM1 (cholinergic receptor, muscarinic 1) encodes a muscarinic cholinergic receptor that is the most abundant muscarinic receptor in the CNS (central nervous system). It is predominantly expressed in the neurons. It is a member of the muscarinic acetylcholine receptor family that conatins five subtypes, CHRM1-CHRM5. These subtypes have high homology but differ in signal transduction mediated via G protein-coupled pathways, resulting in varying physiological responses. The subtypes CHRM1, CHRM3, and CHRM5 have affinity for G proteins of the Gq/11 family and CHRM2 and CHRM4 bind to Gi/o-type G proteins. The gene is mapped to human chromosome 11q13.

Inmunógeno

Muscarinic acetylcholine receptor M1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-CHRM1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Acciones bioquímicas o fisiológicas

The protein encoded by the gene CHRM1 (cholinergic receptor, muscarinic 1) stimulates intracellular Ca²⁺ signaling in response to acetylcholine in striatal cells. The expression of this protein is modulated by heterochromatin condensation and any changes in its structure leads to impaired Ca²⁺ release from ER. The encoded protein enhances phosphatidylinositol (PtdIns) hydrolysis and mobilization of intracellular Ca²⁺. Both CHRM1 and CHRM2 are involved in regulating cholinergic action on glutamatergic and GABAergic nerve terminals in the stiratum and this system has been associated with HD (Huntington′s disease) pathology.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72768

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)