HPA012883

Anti-AGAP3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Arf-GAP, GTPase, ANK repeat and pH domain-containing protein 3, Anti-CRAG, Anti-CRAM-associated GTPase, Anti-Centaurin-γ-3, Anti-MR1-interacting protein, Anti-MRIP-1
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA012883
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry: 1:20- 1:50
• secuencia del inmunógeno: AKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLAPTPNREPANGTNPSAE
• Nº de acceso UniProt: Q96P47
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... AGAP3(116988)

Descripción

Descripción general

AGAP3 (ADP ribosylation factor GTPase activating protein (Arf-GAP) with GTPase, ankyrin (ANK) repeat and pleckstrin homology domain (PH) domain-containing protein 3) is a guanosine triphosphatase (GTPase) which contains a nuclear localization signal (NLS) sequence. It is expressed in the brain and heart. It contains multiple domains involved in signaling like a GTPase-like domain, a PH domain and an ArfGAP domain. AGAP3 exists as a component of the N-methyl-D-aspartate receptor (NMDA) receptor complex.

Inmunógeno

Arf-GAP, GTPase, ANK repeat and pH domain-containing protein 3 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

AGAP3 (ADP ribosylation factor GTPase activating protein (Arf-GAP) with GTPase, ankyrin (ANK) repeat and Pleckstrin homology domain (PH) domain-containing protein 3) has been shown to form nuclear inclusions in response to stress. It induces a ring-like structure of promyelocytic leukemia protein (PML) body. The degradation of polyglutamine (polyQ) at promyelocytic leukemia (PML) bodies is carried out by AGAP3 through the ubiquitin-proteasome pathway. The knockdown of AGAP3 blocks the nuclear translocation of polyQ and also enhances cell death mediated by polyQ. It has been suggested that AGAP3 is involved in the pathogenesis of polyglutamine diseases.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86953

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)