HPA008356

Anti-RET antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: RET Antibody - Anti-RET antibody produced in rabbit, Ret Antibody, Anti-CDHF12, Anti-CDHR16, Anti-HSCR1, Anti-MEN2A, Anti-MEN2B, Anti-MTC1, Anti-PTC, Anti-RET51
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA008356
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
• Nº de acceso UniProt: P07949
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... RET(5979)

Descripción

Descripción general

Proto-oncogene tyrosine-protein kinase receptor Ret (RET) is a receptor for the glial derived neurotrophic factor (GDNF) family of ligands. RET gene codes for the RET receptor protein. RET is predominantly found in the plasma membrane and the cytoplasm. It is mainly expressed in neural tissues, neuroendocrine cells, the digestive tract, adult kidneys, skin, and blood apparatus. RET has an extracellular region, a transmembrane region, and a cytoplasmic region. It also has four cadherin-like domains, a cysteine-rich domain, and calcium-binding sites. RET gene is located on human chromosome 10q11.21.

Inmunógeno

Proto-oncogene tyrosine-protein kinase receptor ret precursor recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-RET antibody produced in rabbit has been used in immunohistochemical analysis (1:250).

Acciones bioquímicas o fisiológicas

Proto-oncogene tyrosine-protein kinase receptor Ret (RET) has four ligands-glial cell-derived neurotrophic factor (GDNF), neurturin, artemin and persephin. The binding of these ligands needs a GPI-anchored coreceptor (GFRα1-4). RET plays an important role in kidney and neural development, and maintains the number of somatotrophs at physiological levels. RET controls a complex network of signaling pathways in enteric nervous system progenitor cells during their development, survival, proliferation, differentiation, and migration. RET gene mutations are associated with medullary thyroid carcinoma (MTC), multiple endocrine neoplasia type 2A (MEN2A), familial medullary thyroid carcinomas (FMTC), multiple endocrine neoplasia type 2B (MEN2B), familial pheochromocytoma predisposition, Hirschsprung disease, congenital central hypoventilation syndrome, and renal hypodysplasia/aplasia 1. It possesses tyrosine kinase activity.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71122

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)