HPA007450

Anti-SPOCK1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-MGC10235, Anti-SPOCK, Anti-TIC1, Anti-sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1, Anti-testican-1
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA007450

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry: 1:50- 1:200
• secuencia del inmunógeno: FKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGG
• Nº de acceso UniProt: Q08629
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SPOCK1(6695)

Descripción

Inmunógeno

sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-SPOCK1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Acciones bioquímicas o fisiológicas

SPOCK1 (sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1) gene encodes a matricellular glycoprotein that belongs to a family of novel Ca2+-binding proteoglycans. The members of this family contain similar N-terminus, follistatin-like domain, and C-terminus. SPOCK1 is also called as testican-1 and is found to function in cell-cycle regulation, apoptosis, DNA repair, and metastasis. It is a key player in the recurrence of prostate cancer, invasion of glioblastoma, and progression of hepatocellular carcinoma. It activates PI3K/AKT pathway, which in turn, inhibits apoptosis and facilitates proliferation and metastasis of gallbladder cancer cells. It serves as a potential cancer prognostic marker. Defects in this gene may cause developmental delay and microcephaly. This gene may function in neurogenesis. It serves as a metastasis related biomarker in lung carcinoma and may be a potential therapeutic target.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST70160

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable