HPA007179

Anti-PTPRN antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-ICA 512 antibody produced in rabbit, Anti-Islet cell antigen 512 antibody produced in rabbit, Anti-Islet cell autoantigen 3 antibody produced in rabbit, Anti-PTP IA-2 antibody produced in rabbit, Anti-R-PTP-N antibody produced in rabbit, Anti-Receptor-type tyrosine-protein phosphatase-like N precursor antibody produced in rabbit
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA007179
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunohistochemistry: 1:200- 1:500
• secuencia del inmunógeno: HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA
• Nº de acceso UniProt: Q16849
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PTPRN(5798)

Descripción

Descripción general

The insulinoma associated protein tyrosine phosphatase 2 (IA-2)/ PTPRN is a transmembrane glycoprotein of 106 kDa. Its expression is seen in neuroendocrine cells. IA-2 is a member of the protein tyrosine phosphatase (PTP) family. It has three domains, such as the extracellular domain, intracellular domain and a single transmembrane domain. This gene is mapped to human chromosome 2q35.

Inmunógeno

Receptor-type tyrosine-protein phosphatase-like N precursor recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-PTPRN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

PTPRN (Protein tyrosine phosphatase, receptor type, N) is involved in the neuroendocrine secretory processes such as biogenesis, trafficking or regulated exocytosis. A study shows that PTPRN is associated with the type 1 diabetes development.

The insulinoma associated protein tyrosine phosphatase 2 (IA-2)/PTPRN is an immunodominant autoantigen, that participates in the autoimmune attack to the β-cell in type 1 diabetes mellitus. It plays a key role in the cytoplasmic transport of dense core secretory granules (DSG) in pancreatic islets.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST70124

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)