Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

HPA005471

Sigma-Aldrich

Anti-PSMC4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-26S protease regulatory subunit 6B antibody produced in rabbit, Anti-MB67-interacting protein antibody produced in rabbit, Anti-MIP224 antibody produced in rabbit, Anti-Proteasome 26S subunit ATPase 4 antibody produced in rabbit, Anti-TAT-binding protein 7 antibody produced in rabbit, Anti-TBP-7 antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:50- 1:200

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PSMC4(5704)

¿Está buscando productos similares? Visita Guía de comparación de productos

Descripción general

The 26S proteasome is an ATP-dependent protease, which is a large complex of multiple subunits. It contains one catalytic subunit, 20S and two regulatory subunits called PA700. In humans, the PA700 contains six members, incluing PSMC4 (proteasome 26S subunit, ATPase, 4). It is also called TBP7 and the corresponding gene is located on chromosome 19q13.11-q13.13. PSMC4 is an ATPase and was initially identified as synphilin-1-interacting protein. Its molecular weight is around 50kDa.

Inmunógeno

26S protease regulatory subunit 6B recombinant protein epitope signature tag (PrEST)

Sequence
LTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLEL

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

Proteasome 26S subunit, ATPase, 4 (PSMC4) regulates the assembly of the 26S proteasome complex. The HbYX motif present at the C-terminal of PSMC4 is essential for the assembly of 26S complex from PA700 and 20S subunits. Interaction of PSMC4 and TRAP1 (Tumor necrosis factor receptor-associated protein-1) leads to increased stress-induced cell death and intracellular protein ubiquitination. Studies also suggest that PSMC4, along with TRAP1, regulates the quality of mitochondria targeted proteins. An insertion/deletion mutation in intron 5 of this gene is found in higher frequency in Parkinson′s disease patients than in control. This mutation is less frequent in late-onset PD patients as opposed to early onset PD patients.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86558

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Brajesh Kumar et al.
The Journal of biological chemistry, 285(50), 39523-39535 (2010-10-13)
PA700, the 19 S regulatory subcomplex of the 26 S proteasome, contains a heterohexameric ring of AAA subunits (Rpt1 to -6) that forms the binding interface with a heteroheptameric ring of α subunits (α1 to -7) of the 20 S
Claudia Wahl et al.
Journal of neural transmission (Vienna, Austria : 1996), 115(8), 1141-1148 (2008-05-01)
Dysfunction of proteasomal protein degradation is involved in neurodegeneration in Parkinson's disease (PD). Recently we identified the regulatory proteasomal subunit S6 ATPase as a novel interactor of synphilin-1, which is a substrate of the ubiquitin-ligase Parkin (PARK2) and an interacting
M R Amoroso et al.
Cell death and differentiation, 19(4), 592-604 (2011-10-08)
Tumor necrosis factor receptor-associated protein-1 (TRAP1) is a mitochondrial (MITO) antiapoptotic heat-shock protein. The information available on the TRAP1 pathway describes just a few well-characterized functions of this protein in mitochondria. However, our group's use of mass-spectrometric analysis identified TBP7
N Tanahashi et al.
Biochemical and biophysical research communications, 243(1), 229-232 (1998-02-25)
The 26S proteasome is a eukaryotic ATP-dependent protease functioning as a protein death machine. It is a large multisubunit complex, consisting of a catalytic 20S proteasome and two regulatory modules, named PA700. The PA700 complex is composed of multiple subunits
Wenyan Lu et al.
Journal of cellular biochemistry, 115(10), 1799-1807 (2014-06-07)
Emerging evidence indicates that activation of Wnt/β-catenin signaling at the cell surface results in inhibition of glycogen synthase kinase 3β (GSK3β), leading to activation of mTORC1 signaling in cancer cells. The low density lipoprotein receptor-related protein-6 (LRP6) is an essential

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico