Saltar al contenido
Merck

HPA004748

Sigma-Aldrich

Anti-TLN1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Talin-1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

secuencia del inmunógeno

LLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSP

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TLN1(7094)

Descripción general

TLN1 (talin 1) is a cytoskeletal protein expressed at cell-extracellular matrix. It is generally a high-molecular-weight molecule, widely distributed from molds to humans. In human, it is localized in a wide range of cells including leukocytes, lung, placenta, liver, kidney, spleen, thymus, colon, skeletal muscle, and heart.

Inmunógeno

Talin-1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-TLN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

TLN1 (talin 1) is involved in the organization of actin filaments. It is also associated with cell spreading and migrating of several cell types. It is associated with tumor formation, migration, and metastasis in different types of cancer. TLN1 helps in cell adhesion by controlling the integrin interactions with extracellular matrix (ECM). It has been reported as a potential diagnostic marker for hepatocellular carcinoma (HCC).

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST70091

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Kun-Peng Fang et al.
Asian Pacific journal of cancer prevention : APJCP, 15(6), 2655-2661 (2014-04-26)
Talin-1 is a cytoskeleton protein that participates in cell migration and plays a role in tumor formation, migration, and metastasis in different types of cancer. Chinese investigators have observed that the levels of Talin-1 protein and mRNA expression in HCC
Mahmoud M Youns et al.
Asian Pacific journal of cancer prevention : APJCP, 14(6), 3819-3823 (2013-07-28)
Hepatocellular carcinoma (HCC) is a major cause of cancer mortality worldwide. The outcome of HCC depends mainly on its early diagnosis. To date, the performance of traditional biomarkers is unsatisfactory. Talins were firstly identified as cytoplasmic protein partners of integrins
Narendra Thapa et al.
The Journal of biological chemistry, 288(48), 34707-34718 (2013-10-24)
A fundamental property of tumor cells is to defy anoikis, cell death caused by a lack of cell-matrix interaction, and grow in an anchorage-independent manner. How tumor cells organize signaling molecules at the plasma membrane to sustain oncogenic signals in
Jian-Lin Zhang et al.
Asian Pacific journal of cancer prevention : APJCP, 12(12), 3265-3269 (2011-01-01)
Hepatocellular carcinoma (HCC) is one of the most lethal and prevalent cancers in the human population. Despite its significance, there is only limited understanding of pathological mechanisms and therapeutic options. Talin1, a focal adhesion complex protein that is required for
T Ben-Yosef et al.
Genomics, 62(2), 316-319 (1999-12-28)
Talin is a high-molecular-weight cytoskeletal protein, localized at cell-extracellular matrix associations known as focal contacts. In these regions, talin is thought to link integrin receptors to the actin cytoskeleton. Talin plays a key role in the assembly of actin filaments

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico