HPA001914

Anti-NFE2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Leucine zipper protein NF-E2 antibody produced in rabbit, Anti-Nuclear factor, erythroid-derived 2 45 kDa subunit antibody produced in rabbit, Anti-Transcription factor NF-E2 45 kDa subunit antibody produced in rabbit, Anti-p45 NF-E2 antibody produced in rabbit
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA001914
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: SRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPES
• Nº de acceso UniProt: Q16621
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NFE2(4778)

Descripción

Descripción general

Nuclear factor erythroid 2 (NFE2) is a transcription factor, involved with the regulation of erythroid and megakaryocytic lineage-specific genes. It is a basic leucine zipper (bZIP) heterodimer with two different sized subunit: hematopoietic-specific larger p45 polypeptide belongs to the cap and collar (CNC) family and widely expressed smaller subunit MafG from the p18/Maf K family.

Inmunógeno

Transcription factor NF-E2 45 kDa subunit recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-NFE2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

NFE2 (nuclear factor, erythroid 2) is involved in regulation of transcription by two means: by modifying chromatin structure and by modulating transcription factor activity. Two domains, p45 and MafG (transcription factor), dimerize to form a composite DNA binding domain. NFE2 positively regulates transcription by binding to a class of specific DNA sequences of erythroid and megakaryocytic genes. Specifically, amino terminal of p45 exerts activator function when binds to several proteins, including the general transcription factor TAFII130 (transcription initiation factor TFIID 130kDa subunit). It has also been reported that sumoylation of p45 enhances the DNA binding affinity of NFE2 which further increase the transactivation capability of NFE2.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST84758

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)