HPA001399
Anti-ADA antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinónimos:
Anti-Adenosine aminohydrolase antibody produced in rabbit, Anti-Adenosine deaminase antibody produced in rabbit
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(10)
About This Item
Número MDL:
Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41
conjugado:
unconjugated
application:
IHC
clon:
polyclonal
reactividad de especies:
human
citations:
8
técnicas:
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:5000-1:10000
immunohistochemistry: 1:5000-1:10000
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Línea del producto
Prestige Antibodies® Powered by Atlas Antibodies
Formulario
buffered aqueous glycerol solution
reactividad de especies
human
validación mejorada
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
técnicas
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:5000-1:10000
secuencia del inmunógeno
GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... ADA(100)
Inmunógeno
Adenosine deaminase recombinant protein epitope signature tag (PrEST)
Aplicación
Anti-ADA antibody produced in rabbit is suitable for use as an antibody suspension bead array in affinity proteomic array to explore the potentiality of the human proteins in plasma to predict disease status during malaria infections.
Anti-ADA antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-ADA antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Acciones bioquímicas o fisiológicas
ADA (adenosine deaminase) gene encodes an enzyme that catalyzes the hydrolysis of adenosine to inosine. It is involved in the maintenance of adenosine homeostasis and plays a role in purine metabolism. It interacts with CD26 and mediates epithelial and lymphocyte cell adhesion. It also transduces co-stimulatory signals in T cells by interacting with CD26, an integral membrane protein. Defects in this gene can cause a deficiency of ADA resulting in severe combined immunodeficiency disease (SCID) with dysfunction of both B and T lymphocytes, impaired cellular immunity and decreased production of immunoglobulins. Overexpression of this enzyme can lead to congenital hemolytic anemia.
Características y beneficios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligadura / enlace
Corresponding Antigen APREST78236
Forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Información legal
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Equipo de protección personal
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
H Kanno et al.
The Japanese journal of experimental medicine, 58(1), 1-8 (1988-02-01)
We report the fourth case of adenosine deaminase (ADA) overproduction associated with hereditary nonspherocytic hemolytic anemia and the molecular analysis of this anomaly. The proband was a 10-year-old Japanese boy, who had an episode of erythroblastosis fetalis during the perinatal
Adenosine deaminase (ADA) isoenzymes ADA1 and ADA2: diagnostic and biological role.
C Gakis
The European respiratory journal, 9(4), 632-633 (1996-04-01)
I De Meester et al.
European journal of immunology, 24(3), 566-570 (1994-03-01)
The relationship between CD26/dipeptidyl peptidase IV, an ectopeptidase involved in T cell activation, and the binding protein for adenosine deaminase (ADAbp) was studied. Monoclonal antibodies (mAb) against CD26 and ADAbp, respectively, showed a similar binding profile on various lymphocyte subsets
Identification of a point mutation in the adenosine deaminase gene responsible for immunodeficiency.
D T Bonthron et al.
The Journal of clinical investigation, 76(2), 894-897 (1985-08-01)
Deficiency of adenosine deaminase (ADA) is the cause of an autosomal recessive form of immunodeficiency. We sought to define, at a molecular level, the mutations responsible for ADA deficiency in the cell line GM-1715, derived from an immunodeficient patient. Full-length
Silvia Ginés et al.
The Biochemical journal, 361(Pt 2), 203-209 (2002-01-05)
The extra-enzymic function of cell-surface adenosine deaminase (ADA), an enzyme mainly localized in the cytosol but also found on the cell surface of monocytes, B cells and T cells, has lately been the subject of numerous studies. Cell-surface ADA is
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico