HPA000658

Anti-TECPR2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Uncharacterized protein KIAA0329/KIAA0297 antibody produced in rabbit
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA000658
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• secuencia del inmunógeno: VSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGTAWEHVPGLQACQLALSTRTVWARCPNGDLARRYGVTDKNPAGDYWKKIPGSVSCFTVTASDELWAVGPPGYLLQRLTKTFSHSHGTQKSSQAAMPHPEDLEDEWEVI
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... KIAA0329(9895)

Descripción

Descripción general

TECPR2 (tectonin beta-propeller repeat containing 2) is an uncharacterized protein of the tectonin β-propeller repeat-containing protein family. It consists of WD (tryptophan-aspartic acid repeat) and TECPR domains.

Inmunógeno

WD repeat-containing protein KIAA0329/KIAA0297

Aplicación

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Acciones bioquímicas o fisiológicas

TECPR2 (tectonin beta-propeller repeat containing 2) acts as a positive regulator of autophagy. Autophagy dysfunction has been implicated in a number of other neurodegenerative diseases. Mutation of this gene implicates autophagy, a central intracellular mechanism, in spastic paraparesis. Autophagy is a process by which proteins and organelles are sequestered in autophagosomal vesicles and delivered to the lysosome/vacuole for degradation.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST70441

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)