AV53607
Anti-TNP1 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-TP1, Anti-Transition protein 1 (duRing Histone to protamine replacement)
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
formulario
buffered aqueous solution
mol peso
6 kDa
reactividad de especies
mouse, dog, human, rat, rabbit, horse, pig
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... TNP1(7141)
Descripción general
TNP1 (transition protein 1) gene also referred to as TP1 encodes a 54 amino acids containing nuclear protein that belongs to nuclear transition protein 1 family. It is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines. It is also a basic protein well conserved in mammalian species. It has a role in spermiogenesis. Mutation in TNP1 gene leads to male infertility.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human TNP1
Aplicación
Anti-TNP1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Acciones bioquímicas o fisiológicas
In mammals, the second stage of spermatogenesis is characterised by the conversion of nucleosomal chromatin to compact, non-nucleosomal and transcriptionally inactive form found in sperm nucleus. This condensation is associated with a double-protein transition. The first transition corresponds to the replacement of histones by several spermatid-specific proteins (also called transition proteins) which are themselves replaced by protamines during the second transition. In the elongating spermatids of mammals, the conversion of nucleosomal chromatin to the compact, non-nucleosomal form found in the sperm nucleus is associated with the appearance of a small set of basic chromosomal transition proteins.
Secuencia
Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
The mouse transition protein 1 gene contains a B1 repetitive element and is located on chromosome 1.
P C Yelick et al.
Genomics, 11(3), 687-694 (1991-11-01)
The gene for mouse transition protein 1 (mTP1) was isolated, sequenced, and chromosomally mapped. The nucleotide sequence of 1895 bp of a 6.4-kb mTP1 genomic subclone was determined to include 788 bp of 5' flanking region, 564 bp of coding
Marvin L Meistrich et al.
Chromosoma, 111(8), 483-488 (2003-05-14)
The transition nuclear proteins (TPs) constitute 90% of the chromatin basic proteins during the steps of spermiogenesis between histone removal and the deposition of the protamines. We first summarize the properties of the two major transition nuclear proteins, TP1 and
K C Kleene et al.
Biochimica et biophysica acta, 950(2), 215-220 (1988-07-13)
We have determined the nucleotide sequence of cDNA clones encoding mouse transition protein 1 (TP1), a basic nuclear protein involved in nuclear condensation during spermiogenesis. The nucleotide sequence predicts that transition protein 1 in rats and mice differs by only
F Chirat et al.
European journal of biochemistry, 198(1), 13-20 (1991-05-23)
The ram transition protein 1 (TP1) is present in spermatid cell nuclei in the nonphosphorylated, monophosphorylated and diphosphorylated forms. Its primary structure was determined by automated Edman degradation of S-carboxamidomethylated protein and of peptides generated by cleavage with thermolysin and
Yasushi Miyagawa et al.
Journal of andrology, 26(6), 779-786 (2005-11-18)
Previously, we examined the relationship between protamine gene variations and human male infertility. In this study, we show specific variability in the transition nuclear protein genes (TNPs) of sterile male patients. Transition nuclear proteins (TPs) are major nuclear proteins that
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico