AV53597
Anti-INHA antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-Inhibin, α
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
40 kDa
reactividad de especies
bovine, goat, sheep, human, pig
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... INHA(3623)
Descripción general
NHA (inhibin, alpha) gene encodes the alpha subunit of inhibins A and B protein complexes that belongs to TGF-beta family. It is localized in the syncytiotrophoblast and the intermediate trophoblast of the placenta and may play a role in the mechanism of labor. INHA is also known as Inhibin α. Activin and inhibin are two closely related protein complexes involved in follicle-stimulating hormone (FSH) synthesis. They are produced in the gonads, pituitary gland, placenta, corpus luteum and other organs.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human INHA
Aplicación
Anti-INHA antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Acciones bioquímicas o fisiológicas
Inhibins facilitates the regulation of numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Loss of expression of inhibinα results in high grade prostate cancer. Follicle-stimulating hormone (FSH) stimulates the secretion of inhibin from the granulosa cells of the ovarian follicles in the ovaries. In turn, inhibin suppresses FSH. Inhibin secretion is diminished by GHRH, and enhanced by insulin-like growth factor-1. Inhibin may involve competing with activin for binding to activin receptors and binding to inhibin-specific receptors. Activin, inhibin and follistatin participate as intraovarian regulatory molecules involved in follicular cell proliferation, differentiation, steroidogenesis, oocyte maturation and corpus luteum function.
Secuencia
Synthetic peptide located within the following region: GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
G M Lambert-Messerlian et al.
Molecular and cellular endocrinology, 225(1-2), 101-108 (2004-09-29)
To date, the only routine clinical application of inhibin or activin measurement in testing for fetal abnormalities has been the use of inhibin A in prenatal screening for trisomy 21 (Down syndrome). Second trimester maternal serum levels of inhibin A
Stefano Luisi et al.
Human reproduction update, 11(2), 123-135 (2004-12-25)
A great deal of new information has arisen in the recent years concerning inhibin physiology and clinical relevance in reproductive medicine. It is now recognized that the two inhibin isoforms, named inhibin A and inhibin B, are produced by the
P van Zonneveld et al.
Human reproduction (Oxford, England), 18(3), 495-501 (2003-03-05)
The cause of declining fertility with age, in women who still have regular menstrual cycles, is not clear. Follicle development, endometrial growth and hormonal patterns were evaluated in cycles of older women (aged 41-46 years; n = 26) who previously
Matías L Stangaferro et al.
Animal reproduction science, 148(3-4), 97-108 (2014-07-09)
Cystic ovarian disease (COD) is an important cause of infertility in dairy cattle. Although many researchers have focused their work on the endocrine changes related to this disease, evidence indicates that intraovarian components play an important role in follicular persistence.
A Kondi-Pafiti et al.
Clinical and experimental obstetrics & gynecology, 40(1), 109-112 (2013-06-04)
The aim of the study was to examine, by an immunohistochemical method, the distribution of Inhibin-A and -B, in placentas from normal and pathological gestations. Sixty-two specimens of placental tissue were examined: i) ten cases from early gestations, ii) 28
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico