AV50803
Anti-ZNF385B antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-FLJ25270, Anti-ZNF533, Anti-Zinc finger protein 385B
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
41 kDa
reactividad de especies
guinea pig, rabbit, mouse, bovine, horse, human, rat, dog
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... ZNF385B(151126)
Descripción general
The gene ZNF385B (Zinc finger protein 385B) is mapped to human chromosome 2q31.2-q31.3. It contains 4 matrin-type zinc fingers. It is present in the germinal center of lymph nodes. ZNF385B is expressed in spleen, lymph node and tonsil.
Inmunógeno
Synthetic peptide directed towards the C terminal region of human ZNF385B
Aplicación
Anti-ZNF385B antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Acciones bioquímicas o fisiológicas
Zinc finger protein 385B (ZNF385B; ZNF533) is a transcription factor. ZNF385B modulates transactivation of p53 and is involved in B-cell apoptosis. The expression of ZNF385B correlates with survival in ovarian carcinomas. Single nucleotide polymorphism in ZNF385B is associated with autism. Similarly, polymorphism in ZNF385B is also linked to nonsyndromic orofacial clefts (NSOC).
Secuencia
Synthetic peptide located within the following region: HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQ
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Shuang Liang et al.
Journal of Zhejiang University. Science. B, 15(3), 264-271 (2014-03-07)
A study in a Caucasian population has identified two single-nucleotide polymorphisms (SNPs) in ZNF533, one in DOCK4, and two in IMMP2L, which were all significantly associated with autism. They are located in AUTS1 and AUTS5, which have been identified as
Jun Wu et al.
DNA and cell biology, 30(1), 47-54 (2010-09-21)
The etiology of nonsyndromic orofacial clefts (NSOC) has been considered "complex" or "multifactorial." Etiologic heterogeneity induces disparities in the results among different populations. The zinc finger protein 533 (ZNF533) and several environmental factors have been revealed to be associated with
Bente Vilming Elgaaen et al.
PloS one, 7(9), e46317-e46317 (2012-10-03)
The oncogenesis of ovarian cancer is poorly understood. The aim of this study was to identify mRNAs differentially expressed between moderately and poorly differentiated (MD/PD) serous ovarian carcinomas (SC), serous ovarian borderline tumours (SBOT) and superficial scrapings from normal ovaries
ZNF385B is characteristically expressed in germinal center B cells and involved in B-cell apoptosis.
Kazutoshi Iijima et al.
European journal of immunology, 42(12), 3405-3415 (2012-09-05)
We previously identified zinc finger (ZF) protein ZNF385B as a molecule specifically expressed in Burkitt's lymphoma (BL) among hematologic malignancies. Here, we investigated ZNF385B expression in healthy B cells in a variety of hematological tissues by RT-PCR and immunohistochemistry. ZNF385B
C D Constantinou-Deltas et al.
Genomics, 12(3), 581-589 (1992-03-01)
The zinc finger motif is a highly conserved tandemly repeated sequence of 28-30 amino acids that was first identified in transcription factor TFIIIA from Xenopus laevis. Subsequently, similar motifs were found and characterized in many genes from mammalian genomes and
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico