Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV50503

Sigma-Aldrich

Anti-ZNHIT3 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-TRIP3, Anti-Zinc finger, HIT type 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

17 kDa

reactividad de especies

pig, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_004764

Nº de acceso UniProt

Q15649

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ZNHIT3(9326)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ZNHIT3

Aplicación

Anti-ZNHIT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

Zinc finger, HIT-type containing 3 (ZNHIT3) is a nuclear receptor interacting protein that interacts with peroxisome proliferator-activated receptor γ (PPARγ) and regulates development and homeostasis. ZNHIT3 may regulate the transcription activity of hepatocyte nuclear factor-4α and may be involved in glucose metabolism.

Secuencia

Synthetic peptide located within the following region: HKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC20204

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Arjen Koppen et al.
Molecular & cellular proteomics : MCP, 8(10), 2212-2226 (2009-07-15)
Nuclear receptors (NRs) are major targets for drug discovery and have key roles in development and homeostasis as well as in many diseases such as obesity, diabetes, and cancer. NRs are ligand-dependent transcription factors that need to work in concert
Hiromi Iwahashi et al.
Diabetes, 51(4), 910-914 (2002-03-28)
Mutations of the hepatocyte nuclear factor-4alpha (HNF-4alpha) gene are associated with a subtype of maturity-onset diabetes of the young (MODY1) that is characterized by impaired insulin secretion in response to a glucose load. HNF-4alpha, which is a transcription factor expressed

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico