Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV49670

Sigma-Aldrich

Anti-SLC22A23 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-DKFZP434F011, Anti-FLJ22174, Anti-SLC22A23, Anti-Solute carrier family 22, member 23

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

45 kDa

reactividad de especies

pig, horse, rabbit, mouse, human, rat, dog

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_056297

Nº de acceso UniProt

A1A5C7-2

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... SLC22A23(63027)

Inmunógeno

Synthetic peptide directed towards the middle region of human SLC22A23

Aplicación

Anti-SLC22A23 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

SLC22A23 (C6ORF85) is a member of transmembrane proteins that mediate the transport of organic ions across the cell membrane by acting as uniporters, symporters and antiporters. Single nucleotide polymorphisms in SLC22A23 gene are reportedly associated with ulcerative colitis.

Secuencia

Synthetic peptide located within the following region: VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Alejandra Serrano León et al.
The American journal of clinical nutrition, 100(1), 289-294 (2014-04-18)
SLC22A23 is an orphan gene in the SLC22 family of organic membrane transporters, and its single-nucleotide polymorphism rs17309827-T was recently nominally associated with intestinal inflammation in a genome-wide association study. Other polymorphisms in the SLC22A23 gene have been associated with
Josefin A Jacobsson et al.
Genomics, 90(5), 595-609 (2007-08-24)
The solute carrier family 22 (SLC22) is a large family of organic cation and anion transporters. These are transmembrane proteins expressed predominantly in kidneys and liver and mediate the uptake and excretion of environmental toxins, endogenous substances, and drugs from

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico