Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV49119

Sigma-Aldrich

Anti-UGT3A2 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-MGC119426, Anti-MGC119429, Anti-UDP glycosyltransferase 3 family, polypeptide A2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

59 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... UGT3A2(167127)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human UGT3A2

Aplicación

Anti-UGT3A2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Acciones bioquímicas o fisiológicas

UDP glycosyltransferase 3 family, polypeptide A2 (UGT3A2) belongs to UDP glycosyltransferase family of enzymes that are involved in the metabolism of small lipophilic compounds. UGT3A2 adds sugars from UDP glucose and UDP xylose to a broad range of substrates to enhance their excretion.

Secuencia

Synthetic peptide located within the following region: HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Peter I MacKenzie et al.
Molecular pharmacology, 79(3), 472-478 (2010-11-23)
The human UDP glycosyltransferase (UGT) 3A family is one of three families involved in the metabolism of small lipophilic compounds. Members of these families catalyze the addition of sugar residues to chemicals, which enhances their excretion from the body. The
Robyn Meech et al.
The Journal of biological chemistry, 287(29), 24122-24130 (2012-05-25)
Recent studies in this laboratory characterized the UGT3A family enzymes, UGT3A1 and UGT3A2, and showed that neither uses the traditional UDP-glycosyltransferase UGT co-substrate UDP-glucuronic acid. Rather, UGT3A1 uses GlcNAc as preferred sugar donor and UGT3A2 uses UDP-Glc. The enzymatic characterization

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico