AV48999

Anti-NEK7 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-NIMA (never in mitosis gene a)-related kinase 7
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 34 kDa
• reactividad de especies: rat, human, mouse, dog, guinea pig, bovine, horse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_598001
• Nº de acceso UniProt: Q8TDX7
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NEK7(140609)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human NEK7

Aplicación

Anti-NEK7antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

NIMA-related kinase 7 (NEK7), a serine/threonine protein kinase is required for the proper formation of spindle during mitosis. NEK7 recruits centrosomal pericentriolar material (PCM) proteins which are required for centriole duplication and spindle pole formation. Optimum activity of NEK7 is necessary for cell cycle progression during M and G1 phase and during cytokinesis.

Secuencia

Synthetic peptide located within the following region: KARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMI

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable