AV48700

Anti-STK3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FLJ90748, Anti-KRS1, Anti-MST2, Anti-Serine/threonine kinase 3 (STE20 homolog, yeast)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 56 kDa
• reactividad de especies: dog, human, mouse, rabbit, rat, pig, bovine
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_006272
• Nº de acceso UniProt: Q13188
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... STK3(6788)

Descripción

Descripción general

STK3 (MST2) codes for serine/threonine kinase 3 that functions to supress growth. It is also known to modulate chromatin condensation during apoptosis. RASSF5 is known to inhibit the autoactivation of Mst2.
Rabbit Anti-STK3 antibody recognizes human, mouse, rat, zebrafish, bovine, and chicken STK3.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human STK3

Aplicación

Rabbit Anti-STK3 antibody is suitable for western blot applications at a concentration of 0.5μg/ml.

Acciones bioquímicas o fisiológicas

Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast ′sterile 20′ (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand.Protein kinase activation is a frequent response of cells to treatment with growth factors, chemicals, heat shock, or apoptosis-inducing agents. This protein kinase activation presumably allows cells to resist unfavorable environmental conditions. The yeast ′sterile 20′ (Ste20) kinase acts upstream of the mitogen-activated protein kinase (MAPK) cascade that is activated under a variety of stress conditions. MST2 was identified as a kinase that is activated by the proapoptotic agents straurosporine and FAS ligand (MIM 134638) (Taylor et al., 1996 [PubMed 8816758]; Lee et al., 2001 [PubMed 11278283]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-11 U26424.1 1-11 12-2826 BC010640.2 1-2815

Secuencia

Synthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable