AV48526

Anti-TRMT11 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-C6orf75, Anti-MDS024, Anti-TRM11, Anti-dJ187J11, Anti-dJ187J11.2, Anti-tRNA methyltransferase 11 homolog (S. cerevisiae)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 53 kDa
• reactividad de especies: human, mouse, horse, bovine, dog, rabbit, rat, guinea pig
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001026882
• Nº de acceso UniProt: Q7Z4G4
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TRMT11(60487)

Descripción

Descripción general

TRMT11-1 codes for tRNA Methyltransferase 11 homolog (S. cerevisiae). It may be involved in the processing of tRNA. Genetic variation in TRMT11 has been analyzed as a biomarker to predict the efficacy of androgen deprivation therapy in prostate cancer patients.
Rabbit Anti-TRMT11 antibody recognizes human, mouse, rat, chicken, canine, and bovine TRMT11.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TRMT11

Aplicación

Rabbit Anti-TRMT11 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Acciones bioquímicas o fisiológicas

TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

Secuencia

Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable