AV48273

Anti-ALDOC antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ALDC, Anti-Aldolase C, fructose-bisphosphate
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 39 kDa
• reactividad de especies: dog, rat, human, bovine, horse, guinea pig, rabbit, mouse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_005156
• Nº de acceso UniProt: P09972
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ALDOC(230)

Descripción

Descripción general

ALDOC codes for a class I fructose-biphosphate aldolase that catalyzes the breakdown of fructose-1,6-biphosphate to dihydroxyacetone phosphate (DHAP) and glyceraldehyde-3-phosphate during glycolysis. It also catalyzes the aldol cleavage of fructose-1 phosphate to DHAP and glyceraldehyde. ALDOC is expressed in the cerebellum, retina and other parts of the CNS. It is known to be upregulated in the brain and skeletal muscles cells of chickens during hypoxia.
Rabbit Anti-ALDOC antibody recognizes bovine, human, mouse, rat, zebrafish, and rabbit ALDOC.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ALDOC

Aplicación

Rabbit Anti-ALDOC antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.

Acciones bioquímicas o fisiológicas

ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Secuencia

Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable