Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV47590

Sigma-Aldrich

Anti-SMC3 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-BAM, Anti-BMH, Anti-CDLS3, Anti-CSPG6, Anti-HCAP, Anti-SMC3L1, Anti-Structural maintenance of chromosomes 3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

74 kDa

reactividad de especies

horse, bovine, rat, human, guinea pig, dog, mouse, rabbit

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SMC3(9126)

Descripción general

SMC3 codes for a part of the cohesion complex that regulates chromosome segregation during mitosis. It is known to form a heterodimer with SMC1, which subsequently can restructure the double helical form of DNA into a series of loops. Studies have reported that the opening of the Smc3-Scc1 gate is needed for removal of cohesion from chromosomes during prophase. However, in Drosophila, the disengagement of Smc3/kleisin interface releases cohesin from chromosomes during mitosis and interphase.
Rabbit Anti-SMC3 antibody recognizes human, mouse, rat, chicken, zebrafish, bovine, and canine SMC3.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human SMC3

Aplicación

Rabbit Anti-SMC3 antibody is suitable for western blot applications at a concentration of 0.25μg/ml. The product can also be used for IHC applications.

Acciones bioquímicas o fisiológicas

SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.

Secuencia

Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Mingxuan Sun et al.
Nucleic acids research, 41(12), 6149-6160 (2013-04-27)
Cohesin plays a critical role in sister chromatid cohesion, double-stranded DNA break repair and regulation of gene expression. However, the mechanism of how cohesin directly interacts with DNA remains unclear. We report single-molecule experiments analyzing the interaction of the budding
Christian S Eichinger et al.
The EMBO journal, 32(5), 656-665 (2013-01-24)
Cohesin's Smc1, Smc3, and kleisin subunits create a tripartite ring within which sister DNAs are entrapped. Evidence suggests that DNA enters through a gate created by transient dissociation of the Smc1/3 interface. Release at the onset of anaphase is triggered
Johannes Buheitel et al.
The EMBO journal, 32(5), 666-676 (2013-01-31)
Faithful transmission of chromosomes during eukaryotic cell division requires sister chromatids to be paired from their generation in S phase until their separation in M phase. Cohesion is mediated by the cohesin complex, whose Smc1, Smc3 and Scc1 subunits form

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico