AV46359

Anti-TARS antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-MGC9344, Anti-ThrRS, Anti-Threonyl-tRNA synthetase
• Código UNSPSC: 12352203

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 78 kDa
• reactividad de especies: rabbit, rat, mouse, human, bovine, horse, dog, guinea pig
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_689508
• Nº de acceso UniProt: Q5M7Z9
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TARS(6897)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TARS

Aplicación

Anti-TARS antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Acciones bioquímicas o fisiológicas

TARS (threonyl-tRNA synthetase) gene also referred to as MGC9344 or ThrRS encodes for an enzyme belongs to class-II aminoacyl-tRNA synthetase family. It enhances the endothelial cell migration and angiogenesis.

Secuencia

Synthetic peptide located within the following region: PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable