AV46329

Anti-XTP3TPA (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-CDA03, Anti-MGC5627, Anti-RS21C6, Anti-XTP3-transactivated protein A
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 19 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_077001
• Nº de acceso UniProt: Q9H773
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... XTP3TPA(79077)

Descripción

Inmunógeno

Synthetic peptide directed towards the middle region of human XTP3TPA

Aplicación

Anti-XTP3TPA (AB1) antibody produced in rabbit has been used for western blotting at a concentration of 0.5μg/ml. It has also been used for immunohistochemistry at a concentration of 4-8μg/ml.

Acciones bioquímicas o fisiológicas

XTP3TPA (XTP3-transactivated protein A) also referred as DCTPP1 or RS21C6 is a 170 amino acid protein expressed in embryonic and highly proliferating cells primarily in liver, kidney, ovary and testis with particularly high expression in cancer cells.DCTPP1 hydrolyses 5-formyl-dCTP and plays a crucial role in the balance of dCTP as well as facilitates the metabolism of deoxycytidine analogs; hence contribute to the preservation of genome integrity.

Secuencia

Synthetic peptide located within the following region: KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable