AV46276

Anti-ASF1B antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ASF1 anti-silencing function 1 homolog B (S. cerevisiae), Anti-CIA-II, Anti-FLJ10604
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 22 kDa
• reactividad de especies: rat, guinea pig, mouse, human, bovine, dog
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_060624
• Nº de acceso UniProt: Q9NVP2
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ASF1B(55723)

Descripción

Inmunógeno

Synthetic peptide directed towards the middle region of human ASF1B

Aplicación

Anti-ASF1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Acciones bioquímicas o fisiológicas

ASF1B [anti-silencing function 1 homolog B (S. cerevisiae)] gene encodes for a protein that belongs to H3/H4 family of histone chaperone proteins and facilitates the histone deposition as well as histone exchange and removal during nucleosome assembly and disassembly. ASF1B interacts with HCF-1 and regulates the progression of cellular DNA replication forks through chromatin reorganization. It also stimulates the viral DNA replication by combining Asf1b to DNA replication components. Additionally, depletion of both the histone chaperones ASF1a and ASF1b in human cells induces hallmark of alternative lengthening of telomeres (ALT) in primary as well as cancer cells.

Secuencia

Synthetic peptide located within the following region: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable