Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV46164

Sigma-Aldrich

Anti-STIP1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-HOP, Anti-IEF-SSP-3521, Anti-P60, Anti-STI1, Anti-STI1L, Anti-Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

63 kDa

reactividad de especies

rat, horse, mouse, human, dog, pig

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... STIP1(10963)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human STIP1

Aplicación

Anti-STIP1 (AB1) antibody produced in rabbit can be used to tag stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) for detection and quantitation by using western blotting at a concentration of 1.25μg/ml.

Acciones bioquímicas o fisiológicas

Stress-induced-phosphoprotein 1 (STIP1) also referred to as Hsp70/Hsp90-organizing protein, HOP, STI1, STI1L or P60 is a co-chaperone that regulates and assists heat shock proteins (major chaperones). STIP1 facilitates the interaction of chaperones Hsp70 and Hsp90 for proper protein folding. Additionally, it assists as a novel biomarker for ovarian cancer. STIP1 secreted by human ovarian cancer cells binds to a bone morphogenetic protein (BMP) receptor, ALK2 (activin A receptor, type II-like kinase 2) and activates SMAD-ID3 signaling pathways. Hence, STIP1-ALK2 pathway promotes cell proliferation in ovarian cancer cells.

Secuencia

Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Naomi Walsh et al.
Cancer letters, 306(2), 180-189 (2011-04-08)
We previously identified Hop as over expressed in invasive pancreatic cancer cell lines and malignant tissues of pancreatic cancer patients, suggesting an important role for Hop in the biology of invasive pancreatic cancer. Hop is a co-chaperone protein that binds
Chia-Lung Tsai et al.
Cell reports, 2(2), 283-293 (2012-08-14)
Stress-induced phosphoprotein 1 (STIP1), a cochaperone that organizes other chaperones, heat shock proteins (HSPs), was recently shown to be secreted by human ovarian cancer cells. In neuronal tissues, binding to prion protein was required for STIP1 to activate the ERK
Anna Carolina Carvalho da Fonseca et al.
Journal of neuroimmunology, 274(1-2), 71-77 (2014-07-22)
Factors released by glioma-associated microglia/macrophages (GAMs) play an important role in the growth and infiltration of tumors. We have previously demonstrated that the co-chaperone stress-inducible protein 1 (STI1) secreted by microglia promotes proliferation and migration of human glioblastoma (GBM) cell

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico