Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV46095

Sigma-Aldrich

Anti-ATIC (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-5-Aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase, Anti-AICAR, Anti-AICARFT, Anti-IMPCHASE, Anti-PURH

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

64 kDa

reactividad de especies

yeast, guinea pig, mouse, human, rabbit, rat

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_004035

Nº de acceso UniProt

P31939

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ATIC(471)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ATIC

Aplicación

Anti-ATIC (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Acciones bioquímicas o fisiológicas

ATIC gene encodes a bifunctional enzyme 5-Amino-4-imidazolecarboxamide ribonucleotide transformylase/IMP cyclohydrolase. The enzyme is responsible for catalysis of the last two steps in the de novo synthesis of inosine 5′-monophosphate. The N-terminal domain comprise of phosphoribosylaminoimidazolecarboxamide formyltransferase activity whereas the C-terminal domain has IMP cyclohydrolase activity. Mutation in ATIC gene results in destabilization of various degrees of purinosome assembly which leads to AICA-ribosiduria.

Secuencia

Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Karen G Bulock et al.
The Journal of biological chemistry, 277(25), 22168-22174 (2002-04-12)
5-Amino-4-imidazolecarboxamide ribonucleotide transformylase/IMP cyclohydrolase (ATIC) is a bifunctional protein possessing two enzymatic activities that sequentially catalyze the last two steps in the pathway for de novo synthesis of inosine 5'-monophosphate. This bifunctional enzyme is of particular interest because of its
Veronika Baresova et al.
Human molecular genetics, 21(7), 1534-1543 (2011-12-20)
The purinosome is a multienzyme complex composed by the enzymes active in de novo purine synthesis (DNPS) that cells transiently assemble in their cytosol upon depletion or increased demand of purines. The process of purinosome formation has thus far been

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico