Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV46090

Sigma-Aldrich

Anti-PEX3 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Peroxisomal biogenesis factor 3, Anti-TRG18

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

42 kDa

reactividad de especies

horse, human, mouse, guinea pig, dog, rabbit, rat, bovine

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PEX3(8504)

Descripción general

Peroxisomal biogenesis factor 3 (PEX3, TRG18), a PEX19 docking protin, and PEX19 have key roles in the biogenesis of peroxisomes. Membrane-anchored PEX3 functions as a PEX19 receptor, wherein PEX19 recognizes newly synthesized peroxisomal membrane proteins (PMP) and recruits them to the peroxisomal membrane.

Especificidad

Anti-PEX3 polyclonal antibody reacts with bovine, human, mouse, rat, canine, zebrafish, and chicken peroxisomal biogenesis factor 3 proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human PEX3

Aplicación

Anti-PEX3 polyclonal antibody is used to tag peroxisomal biogenesis factor 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of peroxisomal biogenesis factor 3 in peroxisome biosynthesis.

Acciones bioquímicas o fisiológicas

PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.

Secuencia

Synthetic peptide located within the following region: KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico