Saltar al contenido
Merck
Todas las fotos(1)

Documentos

AV46056

Sigma-Aldrich

Anti-EIF2S3 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-EIF2, Anti-EIF2G, Anti-EIF2gamma, Anti-Eukaryotic translation initiation factor 2, subunit 3 γ, 52 kDa

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

51 kDa

reactividad de especies

human, dog, rat, bovine, rabbit, guinea pig, mouse, horse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_001406

Nº de acceso UniProt

P41091

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... EIF2S3(1968)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human EIF2S3

Aplicación

Anti-EIF2S3 antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.

Acciones bioquímicas o fisiológicas

EIF2S3 gene encodes a eukaryotic translation initiation factor 2, subunit 3 gamma protein of 52kDa. It is the core subunit of the heterotrimeric GTP-binding protein that facilitates the recruitment of methionyl-tRNA to the 40S ribosomal subunit.

Secuencia

Synthetic peptide located within the following region: LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Guntram Borck et al.
Molecular cell, 48(4), 641-646 (2012-10-16)
Together with GTP and initiator methionyl-tRNA, translation initiation factor eIF2 forms a ternary complex that binds the 40S ribosome and then scans an mRNA to select the AUG start codon for protein synthesis. Here, we show that a human X-chromosomal
M K Ray et al.
Biochemistry, 32(19), 5151-5159 (1993-05-18)
A eukaryotic initiation factor 2 (eIF-2) associated 67-kDa polypeptide (p67) protects the eIF-2 alpha-subunit from eIF-2 kinase(s) catalyzed phosphorylation, and this promotes protein synthesis in the presence of active eIF-2 kinase(s), [Datta, B., et al. (1988) Proc. Natl. Acad. Sci.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico