AV46049

Anti-PAICS antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-ADE2, Anti-ADE2H1, Anti-AIRC, Anti-DKFZp781N1372, Anti-MGC1343, Anti-MGC5024, Anti-PAIS, Anti-Phosphoribosylaminoimidazole succinocarboxamide synthetase
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 47 kDa
• reactividad de especies: dog, rabbit, guinea pig, human, bovine, horse, mouse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_001072992
• Nº de acceso UniProt: P22234
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... PAICS(10606)

Descripción

Descripción general

Phosphoribosylaminoimidazole succinocarboxamide synthetase (PAICS, ADE2H1, AIRC, PAIS) is a bifunctional enzyme involved in de novo purine (adenine, quanine) biosynthesis in vertebrates. PAICS is an important enzyme in rapidly growing tumor cells that rely on de novo purine synthesis. PAICS has both 5-aminoimidazole ribonucleotide carboxylase (AIRc) and 4-(N-succinylcarboxamide)-5-aminoimidazole ribonucleotide synthetase (SAICARs) activities and is a target for potential anticancer drugs.

Especificidad

Anti-PAICS polyclonal antibody reacts with chicken, bovine, human, mouse, and rat phosphoribosylaminoimidazole succinocarboxamide synthetases.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human PAICS

Aplicación

Anti-PAICS polyclonal antibody is used to tag phosphoribosylaminoimidazole succinocarboxamide synthetase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of phosphoribosylaminoimidazole succinocarboxamide synthetase in purine biosynthesis and cancer cell survival.

Acciones bioquímicas o fisiológicas

PAICS is a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene.

Secuencia

Synthetic peptide located within the following region: ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable