AV44289
Anti-PSEN2 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-AD3L, Anti-AD4, Anti-PS2, Anti-Presenilin 2 (Alzheimer disease 4), Anti-STM2
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
formulario
buffered aqueous solution
mol peso
49 kDa
reactividad de especies
bovine, horse, human, dog, rat, guinea pig, rabbit, mouse
concentración
0.5 mg - 1 mg/mL
técnicas
immunohistochemistry: suitable
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... PSEN2(5664)
Inmunógeno
Synthetic peptide directed towards the N terminal region of human PSEN2
Aplicación
Anti-PSEN2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Acciones bioquímicas o fisiológicas
Presenilin 2 (PSEN2; PS2; AD4) regulates the activity of γ-secretase, the enzyme that cleaves amyloid precursor protein (APP). Studies indicate that PSEN2 also might regulate the cleavage of Notch receptor that in turn regulates gamma-secretase activity. Presenilins regulate the release of neurotransmitters at the synapses and intracellular Ca+2 homeostasis. Mutations in gene encoding presenilins are linked to familial Alzheimer′s disease.
Secuencia
Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Bei Wu et al.
Proceedings of the National Academy of Sciences of the United States of America, 110(37), 15091-15096 (2013-08-07)
Presenilin (PS) plays a central role in the pathogenesis of Alzheimer's disease, and loss of PS causes progressive memory impairment and age-related neurodegeneration in the mouse cerebral cortex. In hippocampal neurons, PS is essential for neurotransmitter release, NMDA receptor-mediated responses
Xike Qin et al.
The American journal of pathology, 187(8), 1828-1847 (2017-06-24)
A sporadic form of Alzheimer disease (AD) and vascular dementia share many risk factors, and their pathogenic mechanisms are suggested to be related. Transcription factor early growth response 1 (Egr-1) regulates various vascular pathologies and is up-regulated in both AD
Bruno A Benitez et al.
PLoS genetics, 9(8), e1003685-e1003685 (2013-08-31)
The primary constituents of plaques (Aβ42/Aβ40) and neurofibrillary tangles (tau and phosphorylated forms of tau [ptau]) are the current leading diagnostic and prognostic cerebrospinal fluid (CSF) biomarkers for AD. In this study, we performed deep sequencing of APP, PSEN1, PSEN2
Andrea Pilotto et al.
BioMed research international, 2013, 689591-689591 (2014-01-01)
The discovery of monogenic forms of Alzheimer's Disease (AD) associated with mutations within PSEN1, PSEN2, and APP genes is giving a big contribution in the understanding of the underpinning mechanisms of this complex disorder. Compared with sporadic form, the phenotype
Tomoko Wakabayashi et al.
Physiology (Bethesda, Md.), 23, 194-204 (2008-08-14)
The presenilins in combination with other proteins generate different gamma-secretases, which are involved in the regulated intramembrane proteolysis of a variety of proteins. Understanding the specificity and regulation of these proteases will potentially lead to novel therapeutics for Alzheimer's disease
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico