AV44116

Anti-SLC43A2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FLJ23848, Anti-LAT4, Anti-MGC34680, Anti-Solute carrier family 43, member 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 53 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_689559
• Nº de acceso UniProt: Q8N370-2
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SLC43A2(124935)

Descripción

Descripción general

Solute carrier family 43, member 2 (SLC43A2, LAT4) is a system L amino acid transporter that preferentially transports L-tyrosine. Other members of the L amino acid transporter family include LAT1, LAT2 and LAT3. LAT4 may be an important amino acid transporter during gestation wherein it facilitates amino acid transport from the placenta into the fetus.

Especificidad

Anti-SLC43A2 polyclonal antibody reacts with bovine, canine, rat, and human solute carrier family 43, member 2 proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SLC43A2

Aplicación

Anti-SLC43A2 polyclonal antibody is used to tag solute carrier family 43, member 2 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 43, member 2 in transport of tyrosine during fetal gestation.

Acciones bioquímicas o fisiológicas

SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.

Secuencia

Synthetic peptide located within the following region: TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable