AV44054

Anti-SLC25A28 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-DKFZp547C109, Anti-MFRN2, Anti-MRS3/4, Anti-MRS4L, Anti-NPD016, Anti-Solute carrier family 25, member 28
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 39 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_112489
• Nº de acceso UniProt: Q96A46
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SLC25A28(81894)

Descripción

Inmunógeno

Synthetic peptide directed towards the C terminal region of human SLC25A28

Aplicación

Anti-SLC25A28 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Acciones bioquímicas o fisiológicas

SLC25A28 also known as mitoferrin 2 (MFRN2) belongs to mitochondrial solute carrier family.It transports mitochondrial iron into the developing erythrocytes. High concentrations of iron are highly toxic; the regulation of iron transport in the vertebrate cells by MFRN1 and 2 is therefore critical.

Secuencia

Synthetic peptide located within the following region: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable