AV44019

Anti-SLC30A1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Solute carrier family 30 (Zinc transporter), member 1, Anti-ZNT1, Anti-ZRC1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 55 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_067017
• Nº de acceso UniProt: Q9Y6M5
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SLC30A1(7779)

Descripción

Descripción general

Solute carrier family 30, member 1 (SLC30A1, ZNT1, ZRC1) is a zinc transporter involved in regulating zinc and other divalent cation flux. SLC30A1/ ZNT1 is frequently coexpressed with L-type voltage-dependent calcium channel (LTCC), a major route for zinc influx. SLC30A1/ ZNT1 is believed to regulate cellular ion (calcium, cadmium, zinc) homeostasis, at least in part, by modulating/inhibiting L-type calcium channels.

Especificidad

Anti-SLC30A1 polyclonal antibody reacts with human, canine, and pig solute carrier family 30, member 1/ZNT1 proteins.

Inmunógeno

Synthetic peptide directed towards the middle region of human SLC30A1

Aplicación

Anti-SLC30A1 polyclonal antibody is used to tag solute carrier family 30, member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 30, member 1 in divalent cation (Zn²⁺, Cd²⁺, Ca²⁺) homeostasis, especially in conjunction with L-type voltage-dependent calcium channels.

Acciones bioquímicas o fisiológicas

SLC30A1 may be involved in zinc transport out of the cell.

Secuencia

Synthetic peptide located within the following region: FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable