Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV43810

Sigma-Aldrich

Anti-SLC38A1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-ATA1, Anti-NAT2, Anti-SAT1, Anti-SNAT1, Anti-Solute carrier family 38, member 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

54 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLC38A1(81539)

Descripción general

Solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter 1 (SLC38A1, ATA1, NAT2, SAT1, SNAT1), which is expressed during embryogenesis, is a sodium-dependent transporter of neutral zwitterionic amino acids, such a glutamine. SLC38A1/SAT1 is believed to be involved in translocation of glutamine into GABAergic neurons to facilitate inhibitory neurotransmitter generation.

Especificidad

Anti-SLC38A1 (AB1) polyclonal antibody reacts with canine and human solute carrier family 38, member 1 proteins.

Inmunógeno

Synthetic peptide directed towards the middle region of human SLC38A1

Aplicación

Anti-SLC38A1 (AB1) polyclonal antibody is used to tag solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 38, member 1 in transport of important neutral zwitterionic amino acids, such a glutamine, during embryogenesis and in neural function.

Acciones bioquímicas o fisiológicas

Amino acid transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.

Secuencia

Synthetic peptide located within the following region: LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico