AV41446
Anti-MUC1 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Sinónimos:
Anti-CD227, Anti-EMA, Anti-Mucin, Anti-Mucin 1, cell surface associated, Anti-PEM, Anti-PUM
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
conjugado:
unconjugated
application:
IHC
WB
WB
clon:
polyclonal
reactividad de especies:
dog, human
citations:
6
técnicas:
immunohistochemistry: suitable
western blot: suitable
western blot: suitable
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
IgG fraction of antiserum
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
22 kDa
reactividad de especies
dog, human
concentración
0.5 mg - 1 mg/mL
técnicas
immunohistochemistry: suitable
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... MUC1(4582)
Descripción general
MUC1 (Mucin 1) is O-glycosylated, carbohydrate rich, transmembrane glycoprotein. It has approximately 13 members in the family. It is localized on the apical surface of mucosal epithelia in the lung, eye, breast and stomach. It is overexpressed in several epithelial cancers, including pancreatic ductal adenocarcinoma. It is a heterodimer consisting of N-terminal (MUC1-N) and C-terminal (MUC1-C) subunits. N-terminal (MUC1-N) end contains tandem repeats (VNTR) which forms the mucin component.
Inmunógeno
Synthetic peptide directed towards the C terminal region of human MUC1
Aplicación
Anti-MUC1 (AB2) antibody produced in rabbit is suitable for immunohistochemistry and western blot.
Acciones bioquímicas o fisiológicas
MUC1 (Mucin 1) plays a major role in the formation of epithelium lining of the gastrointestinal tract. It lubricates the gastrointestinal tract to protect the epithelia from oesophagus to the colon. It also lubricates the epithelia of some organs such as pancreas and gall bladder. It is directly involved in several signaling pathways as s a modulator that affects oncogenesis, motility and metastasis.
Secuencia
Synthetic peptide located within the following region: RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Irina I Tyuryaeva et al.
Scientific reports, 7, 40217-40217 (2017-01-17)
Antitumor GO peptides have been designed as dimerization inhibitors of prominent oncoprotein mucin 1. In this study we demonstrate that activity of GO peptides is independent of the level of cellular expression of mucin 1. Furthermore, these peptides prove to
A P Corfield et al.
Frontiers in bioscience : a journal and virtual library, 6, D1321-D1357 (2001-10-02)
Mucins form part of the dynamic, interactive mucosal defensive system active at the mucosal surface of the gastrointestinal tract. They are carbohydrate rich glycoproteins with unique molecular structure and chemical properties. The family of mucin (MUC) genes has 13 members
C J Reid et al.
Gut, 42(2), 220-226 (1998-04-16)
Mucin glycoproteins play a key role in the normal function of the epithelium lining the gastrointestinal tract. The expression of mucin genes, MUC 3, 4, 5AC, 5B, 6, 7, and 8 in human fetal tissues was examined to establish the
N Dharmaraj et al.
Human reproduction (Oxford, England), 29(8), 1730-1738 (2014-06-19)
Are the transmembrane mucins, MUC1, MUC4 and MUC16, differentially expressed in endometriosis compared with normal endometrium? This study revealed that transmembrane mucin expression does not vary significantly in normal endometrium during the menstrual cycle and is not altered in endometriosis
Yaron Niv et al.
World journal of gastroenterology, 20(40), 14913-14920 (2014-10-31)
To determine the expression of membrane-bound mucins and glycan side chain sialic acids in Helicobacter pylori (H. pylori)-associated, non-steroidal inflammatory drug (NSAID)-associated and idiopathic-gastric ulcers. We studied a cohort of randomly selected patients with H. pylori (group 1, n =
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico