AV40922

Anti-MATR3 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Matrin 3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 93 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_061322
• Nº de acceso UniProt: P43243
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MATR3(9782)

Descripción

Descripción general

Matrin 3 (MATR3) is a zinc finger inner nuclear matrix protein with two RNA recognition motifs (RRM). MATR3, which is highly regulated, complexes with and stabilizes specific gene transcripts that are currently being identified. Rev appears to be a MATR3 cofactor.

Especificidad

Anti-MATR3 (AB1) polyclonal antibody reacts with chicken, human, mouse, rat, and bovine matrin 3 proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human MATR3

Aplicación

Anti-MATR3 (AB1) polyclonal antibody is used to tag matrin 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of matrin 3 as a selective nuclear gene transcript stabilizer.

Acciones bioquímicas o fisiológicas

MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.

Secuencia

Synthetic peptide located within the following region: MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable