AV40421

Anti-PTBP1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-HNRNPI, Anti-HNRPI, Anti-MGC10830, Anti-MGC8461, Anti-PTB, Anti-PTB-1, Anti-PTB-T, Anti-Polypyrimidine tract binding protein 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 58 kDa
• reactividad de especies: rat, human, horse, guinea pig, mouse, bovine
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_114367
• Nº de acceso UniProt: P26599
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PTBP1(5725)

Descripción

Descripción general

Polypyrimidine tract-binding protein 1 (PTBP1) is a member of the ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs) subfamily. It has an N-terminal nuclear shuttling domain and four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. PTBP1 is mostly expressed in all cell types. The PTBP1 gene is mapped on human chromosome 19p13.3.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human PTBP1

Acciones bioquímicas o fisiológicas

Polypyrimidine tract-binding protein 1 (PTBP1) plays a key role in T cell activation, spermatogenesis, and splicing. It is involved in the differentiation and development of neuronal cells, growth of embryos and erythrocytes. PTBP1 also participates in apoptosis, glycolysis, migration, metastasis, proliferation, and carcinogenesis due to its role in cancer as a splicing factor. This protein plays a major role in neurodegenerative diseases, cardiovascular diseases, colon cancer, colorectal cancer, breast cancer, glioma, and glioblastoma.

The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. PTBP1 protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. Alternatively spliced transcript variants encoding different isoforms have been described.

Secuencia

Synthetic peptide located within the following region: RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable