AV39728

Anti-ATOH8 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Atonal homolog 8 (Drosophila)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 35 kDa
• reactividad de especies: human, rat, horse, bovine, rabbit, dog, pig
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_116216
• Nº de acceso UniProt: Q96SQ7
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ATOH8(84913)

Descripción

Descripción general

Atonal homolog 8 (Drosophila) (ATOH8) is a basic helix-loop-helix (bHLH) transcription factor involved in the vertebrae tissue-specific differentiation of the nervous system, kidneys, pancreas, retina and muscle during embryogenesis.

Especificidad

Anti-ATOH8 polyclonal antibody reacts with canine, human, mouse, and rat atonal homolog 8 proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ATOH8

Aplicación

Anti-ATOH8 polyclonal antibody is used to tag atonal homolog 8 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of Atonal homolog 8 in tissue-specific differentiation during embryogenesis.

Acciones bioquímicas o fisiológicas

The function of ATOH8 remains unknown.

Secuencia

Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable