AV39663

Anti-MXD3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-MAD3, Anti-MAX dimerization protein 3, Anti-MGC2383
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 23 kDa
• reactividad de especies: horse, mouse, guinea pig, bovine, rat, human, rabbit, dog
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_112590
• Nº de acceso UniProt: Q9BW11
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MXD3(83463)

Descripción

Descripción general

MXD3 is a basic, helix-loop-helix transcription factor that belongs to the MAD family of proteins. This protein is involved in cerebellar development and GNP proliferation. Studies have reported that MXD3 is also required for the proliferation of DAOY medulloblastoma cells.
Rabbit Anti-MXD3 antibody binds to chicken, human, mouse, rat, bovine, zebrafish, and canine MXD3.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human MXD3

Aplicación

Rabbit Anti-MXD3 antibody is suitable for western blot applications at a concentration of 1 μg/ml.

Acciones bioquímicas o fisiológicas

MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5′-CAC[GA]TG-3′. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.

Secuencia

Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable