AV39390

Anti-METTL3 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Methyltransferase like 3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 64 kDa
• reactividad de especies: mouse, rabbit, dog, rat, guinea pig, human, bovine, horse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_062826
• Nº de acceso UniProt: Q86U44
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... METTL3(56339)

Descripción

Descripción general

Methyltransferase like 3 (METTL3 or M6A) codes for a 70 kDa subunit of MT-A. This protein forms a heterodimeric complex with METTL14 and subsequently modulates the methylation of the mammalian nuclear RNA, N6-adenosine.
Rabbit Anti-METTL3 antibody recognizes bovine, canine, human, mouse, rat, and zebrafish METTL3.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human METTL3

Aplicación

Rabbit Anti-METTL3 antibody is suitable for use in western blot (5 μg/ml) and IHC (4-8 μg/ml) applications.

Acciones bioquímicas o fisiológicas

METTL3 is the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

Secuencia

Synthetic peptide located within the following region: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable