AV39341

Anti-TRIM62 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Tripartite motif-containing 62
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 54 kDa
• reactividad de especies: rat, pig, bovine, mouse, horse, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_060677
• Nº de acceso UniProt: Q9BVG3
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... TRIM62(55223)

Descripción

Descripción general

Tripartite motif containing 62 (TRIM62) is a cytoplasmic protein that functions as a RING finger E3 ubiquitin ligase. It is known to catalyze self-ubiquination.
Rabbit Anti-TRIM62 antibody recognizes canine, human, mouse, rat, and bovine TRIM62.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TRIM62

Aplicación

Rabbit Anti-TRIM62 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Acciones bioquímicas o fisiológicas

TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.

Secuencia

Synthetic peptide located within the following region: CSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable