AV39289

Anti-NKRF antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-NF-kappaB repressing factor
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 44 kDa
• reactividad de especies: human, pig, horse, dog
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_060014
• Nº de acceso UniProt: O15226
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... NKRF(55922)

Descripción

Descripción general

NKRF codes for a nuclear protein that functions as a repressing factor for NF-κB. NKRF suppresses the stimulation of hiNOS, IL-8, IFN, and HIV-1 by NFκB.
Rabbit Anti-NKRF antibody recognizes bovine, human, mouse, rat, and canine NKRF.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human NKRF

Aplicación

Rabbit Anti-NKRF antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

Acciones bioquímicas o fisiológicas

NKRF is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. NKRF localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.This gene encodes a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.

Secuencia

Synthetic peptide located within the following region: MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable