AV39172

Anti-POGZ antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Pogo transposable element with ZNF domain
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 155 kDa
• reactividad de especies: rat, mouse, dog, bovine, rabbit, guinea pig, horse, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_055915
• Nº de acceso UniProt: Q7Z3K3
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... POGZ(23126)

Descripción

Descripción general

POGZ is a zinc-finger protein known to interact with HP1α. Studies have reported that POGZ regulates the dissociation of Aurora B kinase from chromosomal arms during the M phase of the cell cycle.
Rabbit Anti-POGZ antibody recognizes human, mouse, rat, canine, rabbit, and bovine POGZ.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human POGZ

Aplicación

Rabbit Anti-POGZ antibody is suitable for western blot (5.0 μg/ml) and IHC (4-8 μg/ml) applications.

Acciones bioquímicas o fisiológicas

POGZ appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid systemThe protein encoded by this gene appears to be a zinc finger protein containing a transposase domain at the C-terminus. This protein was found to interact with the transcription factor SP1 in a yeast two-hybrid system. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed.

Secuencia

Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable