AV39156
Anti-ZHX2 (AB1) antibody produced in rabbit
IgG fraction of antiserum
Sinónimos:
Anti-Zinc fingers and homeoboxes 2
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
IgG fraction of antiserum
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
92 kDa
reactividad de especies
human
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... ZHX2(22882)
Descripción general
ZHX2 belongs to the zinc fingers and homeoboxes gene family and is involved in transcriptional regulation. It forms heterodimers with ZHX3. ZHX2 represses α-fetoprotein (AFP) expression in human hepatoma cells.
Rabbit Anti-ZHX2 antibody recognizes bovine, human, and canine ZHX2.
Rabbit Anti-ZHX2 antibody recognizes bovine, human, and canine ZHX2.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human ZHX2
Aplicación
Rabbit Anti-ZHX2 antibody is suitable for western blot applications at a concentration of 5 μg/ml.
Acciones bioquímicas o fisiológicas
The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. ZHX2 is the member 2 of this gene family. In addition to forming homodimers,this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 2 of this gene family. In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.
Secuencia
Synthetic peptide located within the following region: MASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIGTPQPDVAKDSWAAE
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
H Shen et al.
Journal of cellular and molecular medicine, 12(6B), 2772-2780 (2008-01-16)
The zinc-fingers and homeoboxes 2 (ZHX2) protein was shown previously to be involved in postnatal repression of alpha-fetoprotein (AFP) in mice. More recently, loss of ZHX2 expression was often found in human hepatcellular carcinoma (HCC), where AFP is frequently reactivated.
Hiroko Kawata et al.
Gene, 323, 133-140 (2003-12-09)
Human zinc-fingers and homeoboxes (ZHX) 1, ZHX2 and ZHX3, members of the ZHX family, contain two Cys(2)-His(2)-type zinc-finger motifs and five homeodomains (HDs). These proteins not only form homodimers but heterodimers with ZHX1 as well and act as ubiquitous transcriptional
Elena Manara et al.
Blood, 124(2), 263-272 (2014-04-04)
A rare location, t(6;11)(q27;q23) (MLL-AF6), is associated with poor outcome in childhood acute myeloid leukemia (AML). The described mechanism by which MLL-AF6, through constitutive self-association and in cooperation with DOT-1L, activates aberrant gene expression does not explain the biological differences
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico