AV38652

Anti-TAF6 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80 kDa
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 73 kDa
• reactividad de especies: rabbit, rat, guinea pig, human, dog, bovine, mouse, horse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_620834
• Nº de acceso UniProt: P49848
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TAF6(6878)

Descripción

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TAF6

Acciones bioquímicas o fisiológicas

TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF6 is one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1,the largest subunit of TFIID. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.

Secuencia

Synthetic peptide located within the following region: TVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable