Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV37905

Sigma-Aldrich

Anti-MyBBP1A antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-AL024407, Anti-AU019902, Anti-MyB binding protein (P160) 1a, Anti-P160, Anti-p160MBP, Anti-p67MBP

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

formulario

buffered aqueous solution

mol peso

152 kDa

reactividad de especies

mouse, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

mouse ... Mybbp1a(18432)

Categorías relacionadas

Descripción general

MyB binding protein (P160) 1a (MyBBP1A), a c-myb proto-oncogene product (c-Myb)-interacting protein, is post-translationally processed to 67 kDa fragment (p67MBP). MyBBP1A is primarily expressed in the nucleoli. MyBBP1A which is associated with RNA Polymerase 1 complex and ribosome biogenesis machinery regulates rRNA metabolism and is believed to connect the process of ribosome biogenesis and Myb-dependent transcription to regulate/coordinate cell cycle progression and proliferation.

Especificidad

Anti-MyBBP1A polyclonal antibody reacts with human, rat, and mouse MyB binding protein (P160) 1a proteins.

Inmunógeno

Synthetic peptide directed towards the C terminal region of mouse Mybbp1a

Aplicación

Anti-MyBBP1A polyclonal antibody is used to tag MyB binding protein (P160) 1a protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of MyB binding protein (P160) 1a in the coordination and regulation of rRNA biosynthesis and ribosome biogenesis.

Acciones bioquímicas o fisiológicas

Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.

Secuencia

Synthetic peptide located within the following region: HSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico